SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1R5J5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1R5J5
Domain Number 1 Region: 84-262
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-65
Family F-box associated region, FBA 0.0000593
Further Details:      
 
Domain Number 2 Region: 267-402
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.83e-48
Family F-box associated region, FBA 0.00033
Further Details:      
 
Domain Number 3 Region: 25-103
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000127
Family F-box domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1R5J5
Sequence length 405
Comment (tr|F1R5J5|F1R5J5_DANRE) Si:dkey-147f3.8 {ECO:0000313|Ensembl:ENSDARP00000116121} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=si:dkey-147f3.8 OC=Cyprinidae; Danio.
Sequence
MGSSGAASRVSKSRSEADSGVQLEVPLAVVEKILLNLPAHQVVRVCRLVCHEWKELVDSA
AHWKGRCRREGIQPCDASRPPEDWCQFYILNKNRRNLLKNPKAEAGLQGWEIMGNRKACW
LMEENRKPFPDNTVTRCYVAFNGLCLKRQLIDLQKEGYSAAFMDQLQPDIKISDWYTTTA
PYGIRYRVFMELLNEEMQPISSYHPYRMVLDGDNYPWCEITCVFRNYGPGVRFICFTHGG
SAQFLRGHNGIRLTNSSVEICPAAERLRCTKSNLLINPSAEDGLQGWKMVHSGSGCWVTA
ENSKPLTDTVTRCFVTSFGLCLKRQLIDLQKEGYSDTFMDQVQPHIKISDWYEPRFDCGC
EYQICVELLDQENKPISTFEPEKVVFHFGNSQPWCQVSKVIQKVQ
Download sequence
Identical sequences F1R5J5
ENSDARP00000116121 ENSDARP00000116121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]