SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1R8A6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F1R8A6
Domain Number - Region: 209-252
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0963
Family Tudor domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1R8A6
Sequence length 257
Comment (tr|F1R8A6|F1R8A6_DANRE) Spindlin b {ECO:0000313|Ensembl:ENSDARP00000051773} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=spinb OC=Cyprinidae; Danio.
Sequence
MESPYRTHRSKHTGVRSVSSGRSTMKKKNSHKNRHARAVSPVRPLGQSVVGCRIQHLWKE
DVSSPVSLWKGTVLSQVEVDDSLFLIKYDGVDCVYGLQLFTDDRVRDLELQPGQIASFRV
SDSRLADRLLGRPVVHLFETDDGSKDEWKGLVLSRAPSMPAWFFITYEKDPMLYMYQLMQ
DYRDGDLRLLPDSDEAAELREAGEVSETLVGKQVECLNKDGAQKLGTIIQQVQAKPSVYF
IKFNDDYHIYVYDMVGS
Download sequence
Identical sequences F1R8A6
XP_017212817.1.45394 ENSDARP00000051773 ENSDARP00000051773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]