SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1R8N1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1R8N1
Domain Number 1 Region: 327-590
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-56
Family Nuclear receptor ligand-binding domain 0.0000000749
Further Details:      
 
Domain Number 2 Region: 254-331
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.58e-28
Family Nuclear receptor 0.0000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1R8N1
Sequence length 594
Comment (tr|F1R8N1|F1R8N1_DANRE) Nuclear receptor subfamily 4, group A, member 3 {ECO:0000313|Ensembl:ENSDARP00000072712} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=nr4a3 OC=Cyprinidae; Danio.
Sequence
MPCVQAQYGPPPHGSSYSAQSFGYHGDYSADLMATDYTKCELSGGEISAAAATTSLPSFN
VFVEGGFEPKPSCLYQLPPQRPIIKKEEESFPPMAPSDEAIPGSSMYFKQSPPSTPPTPL
HPGPPSSSFLWDEHSLPPVPQPCLIEGPLKSPRFPHFYEQTVPPSTSGYDTAIGLPLRPE
RSPSSSSSSSHVPPNMDTHAHSHVHSHTHSNMYPINMGKPGGLAFRSLGMGHCPPLLGES
LPSPPNRTSSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLASKNCPVD
KRRRNRCQYCRFQKCLSVGMVKEVVRTDNLKGRRGRLPSKPKSPLQPEPSPPSPPLSLLN
ALVRAYSQSTPRELDYSQVTDAVEPVGLSESQQIQMFYRVLTGSMEVTRCWAERLPGFSE
LHHDDQNMLIDSAFLELFVLRLANRSLLVDEKFVFCTGLVLHRLQCLRGFGEWLDSIRDF
SAHLQELNLDMPAFSCLCALVLLTEQCPGLKEPKKVEELQSKLICCLRDHLNSINAGGVA
STGKAPPPVGAVLGLRAELRSQRTQGLQRIFYLKLEDLVPPPPLIDRFLDTLPY
Download sequence
Identical sequences F1R8N1
ENSDARP00000072712 7955.ENSDARP00000072712 NP_001166100.1.45394 ENSDARP00000072712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]