SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1RAD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1RAD1
Domain Number 1 Region: 335-489
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.98e-26
Family Synaptotagmin-like (S variant) 0.0024
Further Details:      
 
Domain Number 2 Region: 178-311
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.82e-18
Family Synaptotagmin-like (S variant) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1RAD1
Sequence length 500
Comment (tr|F1RAD1|F1RAD1_DANRE) Synaptotagmin XIVa {ECO:0000313|Ensembl:ENSDARP00000113554} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=syt14a OC=Cyprinidae; Danio.
Sequence
SYVNADYHCSSSDSDDEVIGQYQEAVSRSQGLRGGAARTNSRHQKGYGWDTRQKYSPLAA
EYDGYSSEASADDVNCIQRMRRTPPLDELQPPPYQDEDGSPRMSCTPSDLGDAKCDLSHG
SDSPRHSYGKCPSELSGAQETESFLNKGYEEDVPSDSTAVLSPEDLSARGSAAQLPKGYD
PEPLAQYGTLDVVFDYDSSDQRLSISITALTDIPSLKRTGNISWQVHLVLLPTKKQRAKT
IIQRGPCPVFTETFHFSHIESEMIGNYAIRFRLYSVRRMKKEKALGEKVFYLTKLNLQGK
MSVPIILDPYCNIPGSDSQASMSDVSCSETASSYPSAAQGSAPEILLGLVYNATTGRLSV
EVIKGSHFKNLAANKPPNGLFCCLKHLIGGQVYIIRDTYVKLTLLNSMGQEMSKCKTSVC
RGQPNPTYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELTHW
TEMKESKGQQVCRWHSLLES
Download sequence
Identical sequences F1RAD1
ENSDARP00000113554 ENSDARP00000113554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]