SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1RB27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1RB27
Domain Number 1 Region: 7-301
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.7e-58
Family BAR domain 0.000000188
Further Details:      
 
Domain Number 2 Region: 471-615
Classification Level Classification E-value
Superfamily PH domain-like 3.94e-24
Family Phosphotyrosine-binding domain (PTB) 0.018
Further Details:      
 
Domain Number 3 Region: 278-372
Classification Level Classification E-value
Superfamily PH domain-like 5.39e-22
Family Pleckstrin-homology domain (PH domain) 0.0000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1RB27
Sequence length 662
Comment (tr|F1RB27|F1RB27_DANRE) Adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper-containing 2 {ECO:0000313|Ensembl:ENSDARP00000101503} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=appl2 OC=Cyprinidae; Danio.
Sequence
MPAVHHKLLLEEALQDSPQTRSLLSVFEEDAGTLTNYTNQLLQSMQRVFGAQNEMALATE
QLSKQLLEYEKQNFALAKGDEEVINTLQQFAKSVEELNALHSELSTQIADKMVFPMVQFR
EKDLTEISTLKEIFSIATDEHEAAMVKYSRLPKKRENEKVKAEVVREVAYSRRKQHQAAM
QYYCALNALQYRKRVAMLEPMLGYTHAQINFFKKGMELVSKKLDSFLNSVSNMNESIESQ
LEIDAEVMRSSQRELLSVDDSVYMPDHDQAAVSRALIQKAGYLNIRNKTGLVTTAWDRLF
FFTQGGNLMCQPRGAVAGGMVLDLDNSSVMAVDCEDRRYCFQITSPNGKTSLILQAESKR
EYEEWICTLNNISRQIYLTDNPEAVAIKLHQTALQAVTPITSFEKRAEGSPNPDRAKPGG
LPVTSQEAEKSSVSLEPEDLIVPGTPIQFDIMLPASEFLDQNRAGARRTNPFGETEEDDD
ESDTHDSLLQQVFAVRFLGSMAVRSGHTQEVIYEAMRQVLAARAIHNIFKTTESHLMISS
SCIRLIDPQTQVTKISFQLQDVSEFAAHQENERLMGFVVRSSAEDDEPSFSVFVFESNTE
GEKICYTINLAKEIADARKDPEALAQLMKSMPLTNDGKFLLLDNETGDTAETAGQEEQES
EA
Download sequence
Identical sequences F1RB27
ENSDARP00000101503 XP_005174316.1.45394 ENSDARP00000101503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]