SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1RC78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1RC78
Domain Number 1 Region: 90-163
Classification Level Classification E-value
Superfamily F-box domain 3.79e-16
Family F-box domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1RC78
Sequence length 189
Comment (tr|F1RC78|F1RC78_DANRE) F-box protein 36a {ECO:0000313|Ensembl:ENSDARP00000028616} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=fbxo36a OC=Cyprinidae; Danio.
Sequence
MASLLDEILFETAGQGPPPSKDFYQLVITRKEVIWRCWKISIRAESRGAPPGETKQFHDD
FLNDSRMQEQLAVVFGSGILEYTLALCRGHFDYLERLPDKLLLTILSYISLQDIGHLSQT
SNRFRKLCNSEEIWKKTVLGHCDGITEDMEMLAKVMGWKKIFFGFYHEKDPVSTASPAKE
EDNTNRASP
Download sequence
Identical sequences F1RC78
ENSDARP00000028616 ENSDARP00000028616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]