SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1RDU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1RDU0
Domain Number 1 Region: 37-107
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000107
Family HLH, helix-loop-helix DNA-binding domain 0.0041
Further Details:      
 
Weak hits

Sequence:  F1RDU0
Domain Number - Region: 110-132
Classification Level Classification E-value
Superfamily Orange domain-like 0.000955
Family Hairy Orange domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1RDU0
Sequence length 253
Comment (tr|F1RDU0|F1RDU0_DANRE) Hairy-related 3 {ECO:0000313|Ensembl:ENSDARP00000099080} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=her3 OC=Cyprinidae; Danio.
Sequence
XLNSRKSDSPYSSGFFKHTEHLRTMAAASNSAATAKPQNVKKVSKPLMEKKRRARINKCL
NQLKSLLESACSNNIRKRKLEKADILELTVKHLRHLQNTKRGLSKACDSAEYHAGYRSCL
NTVSHYLRASDTDRDSRSIMLTNLTSGLNHNRVPDFSTVESDPALIFTLPSTLRRPHKVP
IRTDVSYSSFQQTAERKVCLMPKRTEIGDSDRMSLDAALRSQESKKAETTHFRPKDLKVI
ECCIFKQNYWRPW
Download sequence
Identical sequences F1RDU0
ENSDARP00000099080 ENSDARP00000099080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]