SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1REP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1REP0
Domain Number 1 Region: 432-556
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.68e-39
Family Ypt/Rab-GAP domain of gyp1p 0.0000489
Further Details:      
 
Domain Number 2 Region: 327-456
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.62e-33
Family Ypt/Rab-GAP domain of gyp1p 0.0000404
Further Details:      
 
Domain Number 3 Region: 237-324
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-17
Family Ypt/Rab-GAP domain of gyp1p 0.00024
Further Details:      
 
Weak hits

Sequence:  F1REP0
Domain Number - Region: 84-137
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.0883
Family Skp1 dimerisation domain-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1REP0
Sequence length 567
Comment (tr|F1REP0|F1REP0_DANRE) TBC1 domain family, member 22a {ECO:0000313|Ensembl:ENSDARP00000066923} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=tbc1d22a OC=Cyprinidae; Danio.
Sequence
MSSDGNKKQFWKRNTAKVPGNIQHVYGAQHPPFDPLLHANLMKAGNKPPSASTPGKPKKA
TTFQEFESITSDAWDVGDDDDELLAMAAQNLNIEVVMETANKVIENHSKLQERRQQQMEK
TTEPDEKYGEEVEEEEEEPEEEEEREEVVETTDVSFSSDALPFGDSRLVKSHSEAPIGSP
KEVGIEQAALHRQQSLPHRPVIPLVARMADQNTSGTPAMTEREASRLDKFRQVLAGPNTD
LEELRKLSWSGIPRQVRPITWKLLSGYLPANAERRESTLQRKRQEYFGFIEQYYDSRNDE
HHQDTYRQIHIDIPRMSPESLVLQPKVTEIHIDIPRTNPLIPLFQQASVQEIFERILFIW
AIRHPASGYVQGINDLVTPFFVVYVFEYIEEEVENFNVSSLQEEVLRNIEADSFWCMSKL
LDGIQDNYTFAQPGIQRKVKALEELVSRIDETVHRHMQLYEVEYLQFAFRWMNNLLMREL
PLRCTIRLWDTYQAEPEGFSHFHLYVCAAFLVRWRKEILEEKDFQGLMILLQNLPTMHWG
NEEVSVLLAEAYRLKFAFADAPNHYKR
Download sequence
Identical sequences F1REP0
ENSDARP00000066923 ENSDARP00000066923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]