SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1RSU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1RSU6
Domain Number 1 Region: 518-756
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000128
Family Protein kinases, catalytic subunit 0.01
Further Details:      
 
Domain Number 2 Region: 44-71
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000249
Family CCCH zinc finger 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1RSU6
Sequence length 906
Comment (tr|F1RSU6|F1RSU6_PIG) Poly(A)-nuclease deadenylation complex subunit 3 {ECO:0000256|HAMAP-Rule:MF_03181} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=PAN3 OC=Sus.
Sequence
MNSGGGLPPPSAAASSSSSSLAAAVAVVAPPGVGGVPGGAAAGVKLKYCRYYAKDKTCFY
GEECQFLHEDPAAGAAPGLGLHSNSVPLALAGAPGAGFPPGAVPGGGAGPPPGPKKPDLG
GPGAGAAVGGGGGSGVLDGPRLAIPGIDGGALTESSLTDSYFSTSFIGVNGFGSPVETKY
PLMQRMTNSSSSPSLLNDSAKPYAGHDPLISPASSLFNDFGALNISQRRKPRKYRLGMLE
ERLVPMGSKARKAKNPIGCLADRCKSGVPINMVWWNRVTENNLQTPNPTASEFIPKGGSA
SRLSNVSQSHMSAFSQVFSHPSLGTPAAAALAPGMSLSAGSSPLHSPKITPHTSPAPRRR
SHTPNPASYMVPSSASTPVNHPVPQTPSSGQVIQKETVGGTTYFYTDSTPAPVSSVRSFK
NYHRTACRTEGQIIEVFPNYHIYPPTAPHVAYMQPKANAPSFFMADELRQELINRHLITM
AQIDQADMPAVPTEVDSYHSLFPLEPLPPPNRIQKSSNFGYITSCYKAVNSKDDLPYCLR
RIHGFRLVNTKCMVLVDMWKKIQHSNIVTLREVFTTKAFSEPSLVFAYDFHAGGETMMSR
HFNDPNADAYFTKRKWGQHDGPLPRQHAGLLPESLIWAYIVQLSSALRTIHTAGLACRVM
DPTKILITGKTRLRVNCVGVFDVLTFDNSQNNNPLALMAQYQQADLISLGKVVLALACNS
LAGIQRENLQKAMELVTINYSSDLKNLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQ
MRNDVIEEDLAKEVQNGRLFRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQ
VTEAGAPWIDLSHIISCLNKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIA
AANGQL
Download sequence
Identical sequences F1RSU6
XP_005668351.1.46622 XP_020921181.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]