SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1RWI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1RWI4
Domain Number 1 Region: 74-121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000034
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 2 Region: 35-76
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000106
Family Somatomedin B domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1RWI4
Sequence length 264
Comment (tr|F1RWI4|F1RWI4_PIG) Somatomedin B and thrombospondin type 1 domain containing {ECO:0000313|Ensembl:ENSSSCP00000006594} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=SBSPON OC=Sus.
Sequence
MRTLWMALCALARLWPGALGGCADAGRCCPGRDPACFASGWRLDRVYGTCFCDQACRLTG
DCCFDYARACPARPCIVGEWSPWSGCADQCKPTARVRRRAVRQEPQNGGAPCPALEERAG
CLEYATAQGQDCGHAFVPAFITTSAFNKERTRRAASPQWSADTEDAGYCMEFKTESLTHH
CALENRPLTRWMQYLREGYTVCVGCQPPAMNAVSLRCSGDGLDSDGNQTLHWQAIGNPRC
QGTWKKVRRVEQCSCPAVHSFIFI
Download sequence
Identical sequences F1RWI4
XP_020944894.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]