SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1S2L7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1S2L7
Domain Number 1 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 233-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-21
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.18e-20
Family KRAB domain (Kruppel-associated box) 0.00043
Further Details:      
 
Domain Number 4 Region: 288-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.39e-20
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 5 Region: 179-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.28e-20
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 456-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 349-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-18
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 8 Region: 595-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-18
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 9 Region: 512-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.43e-18
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 10 Region: 136-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000452
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 11 Region: 94-149
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000193
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 12 Region: 559-591
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000103
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1S2L7
Sequence length 659
Comment (tr|F1S2L7|F1S2L7_PIG) Uncharacterized protein {ECO:0000313|Ensembl:ENSSSCP00000014580} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=LOC102166940 OC=Sus.
Sequence
MDSVTFDDVVVNFTLEEWALLDPSQKKLYRDVMEETLRNLASLGKTWEDHDVGDQYRNHG
GKLRSPLVERLSKHKDSSLCGENFSLIPSLNLKKKTTGSKPCECHSCGTVFMDHSSLKRH
IRCHTEHTPGEFQNFGDKLYECKHCGKAFNHFTSFLMHKRGHTGRKLYECKTCFKALSSP
SSLRYHQRTHTREKPYECKECGEAFTWLITFQKHMITHTGDGPYKCKECEKIFINPSSLK
MHERNHTGEKPYQCEECGKAFKHRQSRHTHEKIHTGEKPYDCKKCGKAFKLRQSIRRHER
IHTGEKPYECKRCGKAFRYHHNFQKHEQTHTGEKPYRCKHCGKALSSLRYCRIHEITHTG
AKPYECKQCGKAFSCPSYFIKHERTHSGLKPYECKLCGKAFSCASYIRRHERTHTGEKPY
KCKKCGKGFSCSSSFRKHERTHTGEKPYECKQCGKAFSYSRSFRSHERRHSGEKPYKCQS
CGKAFTCPNSCRKHERIHSGQKPYVCKECGKAFSSLTKFQRHMMKHTGDGPYKCKDCGKL
FDCPSYFHCHERTHSGEKPYKCKQCGKDFGFPCCRQIRERSHIGERPYRCKQCGKHERTH
TGEKPYECKECGKAFIYPSNVQRHMITHTSDGPCKCKVCGKAFDCPSSLQTHKKTHNGE
Download sequence
Identical sequences F1S2L7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]