SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1S4M1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1S4M1
Domain Number 1 Region: 1124-1300
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.00055
Further Details:      
 
Domain Number 2 Region: 686-801
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.16e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0013
Further Details:      
 
Domain Number 3 Region: 453-575
Classification Level Classification E-value
Superfamily PH domain-like 4.82e-24
Family Pleckstrin-homology domain (PH domain) 0.0000138
Further Details:      
 
Domain Number 4 Region: 908-1039
Classification Level Classification E-value
Superfamily PH domain-like 1.82e-21
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 5 Region: 1435-1570
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-17
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 
Domain Number 6 Region: 588-701
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000191
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 
Domain Number 7 Region: 5-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000412
Family SAM (sterile alpha motif) domain 0.0000598
Further Details:      
 
Domain Number 8 Region: 1016-1116
Classification Level Classification E-value
Superfamily PH domain-like 0.000000153
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1S4M1
Sequence length 1708
Comment (tr|F1S4M1|F1S4M1_PIG) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 {ECO:0000313|Ensembl:ENSSSCP00000009346} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=ARAP2 OC=Sus.
Sequence
MSSVSEVNVDIKDFLMSINLEQYLLRFREFGFNNVMDCTGINDSVLLKVGISPTGHRRRI
LKQLQIILSKMQDIPVYANVHKAKKSDETSDDHHAPPSDQNRCVELSDSHGVPTPSPVPS
EPVTKNLDQNEASVENSQSLKSDDKLTLPTHNLPLPEEEPHLNSGSFQDSLFGSEITEVE
SLMDKKPMDCTTEEEQTEVDLMSENMSKLPHADSEFLSTPGCSLSEAHSGNETNGLLERS
PPPSFFQFQGEMVVNDLYVPSSPVVTPVRSQSKLVSGPSRSFLLRHRPVPEIPGSKTGIS
GSYFHERRNVPTSTGRSVTQQNSNEENSSSILPYGETFLFQKLENSKKKSIKNEFWMHEE
TPKGETTTERSSFFVKSSIYDNRTENITEDKVEDIWIPRQDKNNLPIDSASESEYSTVEE
CFQSLRRKNSKPSKSRTQKALNLDPVNRHSYPLSSTSGNADSSIISSNVISPYACFYGSS
VKKVKSGWLDKLCPQGKRMFQKRWVKFDGVSISYYNNDKEKYSKGIIPLSAISTVRVQGD
NKFEVVTTQRTFVFRVEKEEERNDWISILLNALKLQALSSQSQAAVAPEKCGYLELRGYK
AKIFTVLSGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRTAKQSFEIITPYRSFSFT
AESEKEKQEWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVIC
KKCAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKEEELHVD
SPVEKRKNFITQKYKEGRFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMC
ATGDPEHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHSEGGLSQESSPSMFLCDFLY
QAPAAASKLSSEKKLLEETNKKWCVLEGGFLSYYESDKSTTPNGTININDVICLAVNKED
FCINTGPIFTFEIYLPSERAFLFGAETSQAQRKWTEAIAKHFVPFVAENLTEADYDLIGQ
LYYKDCHALDQWRKGWFAMDKSSLRFCLQMQEGQEDRMNLRRLQELTISTMVQNGEKLDV
LLLVEKGRTLYIHGHTKLDFTVWHIAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVT
QYGLGCKYIYQKNGDPLHISELLESFKKDARSFKLRAGKHQLEDVTGVLKCFLSDIDDAL
LTKELYPYWISALDTQDDKERIKKYGAFIRTLPGVNRATLAALIEHLYRVQKCSEINHMN
AHNLALVFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDT
QVSQAGDLLIEVYVERKEPDCSIIIRISPVMEAEELTTDILAIKNIIPMKDDIWATFEVI
ENEELERPLHYTENVLEQVLRWSSLAEPGAAYLVVKRFLTIDTIKHYNERKTLENIKEGV
LKIKEEPSKILSGNKFQDRYFILRDAYLFLYKDLKSSKPDKMLSVSSMKFYLGVKKKMKP
PTSWGLTAYSEKHHWHLCCDSSQTQMEWMAYVFIAQHENDLWPPAGKERKRSITKNPKIG
GLPLIPIQHERNATQARREIESARAELERLRLGAKHELELGDGTLKERASLVAQCLEHKD
EKLRNRTRKHRSFNCLEDTETEVFQGQEKSHKGVKTLRKTEDRNGKATLDSNNKLPPKVI
EELSVVLQRSRILAKELQGEQIVQKEIK
Download sequence
Identical sequences F1S4M1
9823.ENSSSCP00000009346 ENSSSCP00000009346 ENSSSCP00000009346 XP_003128954.1.46622 XP_020956749.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]