SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1S6A4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F1S6A4
Domain Number - Region: 470-556
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0314
Family Di-heme elbow motif 0.067
Further Details:      
 
Domain Number - Region: 605-631
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0641
Family A20-like zinc finger 0.051
Further Details:      
 
Domain Number - Region: 656-685
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0998
Family A20-like zinc finger 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1S6A4
Sequence length 785
Comment (tr|F1S6A4|F1S6A4_PIG) Uncharacterized protein {ECO:0000313|Ensembl:ENSSSCP00000004489} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=TNFAIP3 OC=Sus.
Sequence
MAEQLLPLALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKSMHRYTLEMFRTCQFCPQF
REIIHKALIDRNIQASLESQKKLNWCREVRKLVALKTNGDGNCLMHAASQYMWGVQDTDL
VLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWTEEWDNLIKMASTDTP
VARSGLQYNSLEEIHIFVLCNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHWPA
QECYRYPIVLGYDSQHFVPLVTLKDSGPEIRAIPLVNRERGRFEDLKVHFLTDPENEMKE
KLLKEYLTVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENN
EQGRRATHPQNPLEPSVPQLSLMDIKCETPNCPFFMSVNTQPLCHECSERRQKNQSKPPK
PTSKPDPEALPGLALGASRGEAWNPEEPSGGPRSAPPTAPSLFLFSETTAMKCRSPGCPF
TLNVQHNGFCERCHNARQLNPGHPPDPTRHLDPSKCQACLQNVTRTFNGICSTCFKRTTA
EPASSLGSSIPLSCHQRSKSDPSQLAQSVSPHPCRRAGPEAPSGCSASAARTPGDRTGTS
KCRKAGCMYFGTPENKGFCTLCFIEYRENKHFVTASGKASPTASRFQNAVPCLGRECGAL
GSTVFEGYCQKCFIEAQNQRFHEAKRTEEQLRLSQRRDLSRATQSASRSKCARATCRNVL
ACCSQELCIECQPLGQRVSPGARRPEPVPEDPPTQRCRAPACDHFGNAKCNGYCNECFQF
KQMYG
Download sequence
Identical sequences F1S6A4
ENSSSCP00000004489 ENSSSCP00000004489 ENSSSCP00000030947 XP_005659239.1.46622 XP_013847984.1.46622 XP_020933283.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]