SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1SCQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1SCQ2
Domain Number 1 Region: 39-127
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.78e-23
Family SCAN domain 0.0026
Further Details:      
 
Domain Number 2 Region: 349-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.53e-20
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 3 Region: 310-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000383
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1SCQ2
Sequence length 439
Comment (tr|F1SCQ2|F1SCQ2_PIG) Zinc finger and SCAN domain containing 4 {ECO:0000313|Ensembl:ENSSSCP00000004308} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=ZSCAN4 OC=Sus.
Sequence
MDLDLRLSFQGEPSRNDPGSENLALKASQGYVIRDGEGISEFPNTRLSLFQNSSNSFARR
ELQRLYNLFHSWLQPEKRSKDEMISCLVLEQFVINGHCSDRSTLQEKWNASGRNLEKFME
DLTDDGMKQPGFVHVHMQGQEALFSENMPLREVLVHFRKHLATATPRGENTKAPLWTPRD
ASLETGQESEGKECGGNTSRKTCPVTESLTWQGSQTPFLLIIPEETCPGLEEAGVSPENP
LGSRTAEPGLAVSQEGSPEGPFGGDVHLEAEPGFLSRPDQVTLEPVSAHPSLEGNPARGK
SPEGLPGAQKVFPCEKCSQVFRYLSRLKVHQRRHNDERPFVCAKCKKGFFQTSDLRVHQR
IHTKEKPFRCSTCKRPFSHKTNLRAHERIHTGEKPYLCSLCQRRYRQSSTYNRHLKSHQK
LALKGDLSGVPVVAQRKRI
Download sequence
Identical sequences F1SCQ2
ENSSSCP00000004308 ENSSSCP00000004308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]