SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1SCQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1SCQ7
Domain Number 1 Region: 277-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 333-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 68-131
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-21
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 4 Region: 417-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.35e-21
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 5 Region: 459-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.24e-18
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 380-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000473
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 239-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000215
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Weak hits

Sequence:  F1SCQ7
Domain Number - Region: 2-40
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00215
Family SCAN domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1SCQ7
Sequence length 524
Comment (tr|F1SCQ7|F1SCQ7_PIG) ZFP69 zinc finger protein B {ECO:0000313|Ensembl:ENSSSCP00000004302} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=ZFP69B OC=Sus.
Sequence
MLQQLLITLPAEASTWVKLCHPEKATEGAPLWEDVTKMLEGEALLSQDANETQGKSLKVE
VTPRDPTAEPQEQLTFRDVSVDFTQEEWGQLAPAHRHLYREVMLENYGNLVSVARYQLSK
PSVISQLEKGEEPWMTEKEGPGDPSSGLTSKTETSVSTAENDIVQEQLYHSMMMERLMRD
DVIYSTLREVSKYDYELERQQDSCGRDMRQTIWTHKKRGQETSKFGRSITSSNIVIEQRH
HKCDMPKKRNKYKSNLINHPMSYIRTKTYECNICEKVFKQPIHLTEHMRIHTGEKPFRCK
ECGRAFSQSASLNTHQRIHTGEKPFECEECGKAFRHRSSLNQHHRTHTGEKPYVCDKCQK
AFSQNISLIQHLRTHSGEKPFTCNECGKTFRQIRHLSEHVRIHTGEKPYACTACCKTFSH
RAYLTHHQRIHTGERPYKCKECGKAFRQRIHLSNHKTVHTGVKAYECKRCGKAYRHDSSF
KKHQRHHTGEKPYECNECGKAFSYNSSLTRHHEIHRRNAFQDNM
Download sequence
Identical sequences F1SCQ7
ENSSSCP00000004302 XP_005665581.1.46622 XP_013832839.1.46622 XP_013832840.1.46622 ENSSSCP00000004302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]