SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1SDE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1SDE5
Domain Number 1 Region: 44-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.05e-35
Family SCAN domain 0.0000536
Further Details:      
 
Domain Number 2 Region: 656-712
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 460-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 599-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 5 Region: 404-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 543-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 701-753
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-20
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 8 Region: 166-225
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.32e-19
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 9 Region: 347-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.65e-17
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 10 Region: 506-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000239
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1SDE5
Sequence length 760
Comment (tr|F1SDE5|F1SDE5_PIG) Zinc finger protein 287 {ECO:0000313|Ensembl:ENSSSCP00000019106} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=ZNF287 OC=Sus.
Sequence
MFSPGKRTASSSRAQVLLTWKPDKAQGGPRNAEKEILAARLLRDTETCRQNFRNFPYPDL
AGPRKALNQLRELCLKWLRPEIHSKEQILELLILEQFLTILPGEVRTWVKSQYPRSSEEV
VTLVEDLTQILEEEAASQNSALSQETPEEDSKGRQAFQAGWLNDLVTKESMTFKDVAVDI
TQEDWELMRPVQKELYKTVTLQNYWNMVSLGLTVYRPTVIPILEEPWMVIKEILEGPSPE
WETEAQEGPPAENISKLTKDETKPIKLEEPYDYENTMEGQATGTFRRIPTKRDFNLKSVL
SQEDDPTEEYFSKYSIYTSNFEKHPNLIIQFGTQSDDKTFVYDERAAFNHVSYGIVHRKI
YPGEKPYKCNVCGKKFRKYPSLIKHQSSHAKEKSYECEECGKEFRHVSSLIAHQRMHTGE
KPYECHQCGKAFSQRAHLTIHQRIHTGEKPYRCDDCGKDFSQRAHLTIHQRTHTGEKPYR
CLECGKTFSHSSSLINHQRVHTGEKPYICNECGKTFSQSTHLLQHQKIHTGKKPYKCNEC
WKVFSQSTYLIRHQRIHSGEKCYKCNECGKAFAHSSTLIQHQTTHTGEKSYICNICGKAF
SQSANLTQHHRTHTGEKPYKCSVCGKAFSQSVHLTQHQRIHNGEKPFKCNICGKAYRQGA
NLTQHQRIHTGEKPYKCNECGKAFIYSSSLNQHQRTHTGERPYKCNECDKDFSQRTCLIQ
HQRIHTGEKPYACRVCGKTFTQSTNLIQHQRVHTGGRHRN
Download sequence
Identical sequences F1SDE5
XP_003132075.2.46622 ENSSSCP00000019106 ENSSSCP00000019106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]