SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1SEY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1SEY2
Domain Number 1 Region: 491-547
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-21
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 2 Region: 213-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-21
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 434-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.29e-21
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 4 Region: 270-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.37e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 326-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.3e-19
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 6 Region: 546-603
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-18
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 7 Region: 657-705
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-18
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 8 Region: 21-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-18
Family KRAB domain (Kruppel-associated box) 0.00078
Further Details:      
 
Domain Number 9 Region: 378-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.21e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 157-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.47e-17
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 11 Region: 603-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000363
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 12 Region: 103-158
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000041
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1SEY2
Sequence length 721
Comment (tr|F1SEY2|F1SEY2_PIG) Uncharacterized protein {ECO:0000313|Ensembl:ENSSSCP00000014589} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=LOC102166940 OC=Sus.
Sequence
KNLHSHQQCRKISFSPHPLQHLTFDDVVVNFTLEEWALLDPSQKKLYRDVMEETLRNLAS
LGKNNDFPSLRQLENKCSILSKHKDSSLCGENFSLIPSLNLKKKTTGSKPCECHSCGTVF
MDHSSLKRHIRCHTEHTPGEFQNFGDKLYECKHCGKAFNHFTSFLMHKRGHTGRKLYECK
TCFKALSSPSSLRYHQRTHTREKPYECKECGEAFTWLITFQKHMITHTGDGPYKCKECEK
IFINPSSLKMHERNHTGEKPYQCEECGKGFSYVSSLRIHKGSHTGEKLYVCKTCSKVLSS
LGSLRNHERIHTGEKPYECKECGKHRQSRHTHEKIHTGEKPYDCKKCGKAFKLRQSIRRH
ERIHTGEKPYECKRCGKAFRYHHNFQKHEQTHTGEKPYRCKHCGKALSSLRYCRIHEITH
TGAKPYECKQCGKAFSCPSYFIKHERTHSGLKPYECKLCGKAFSCASYIRRHERTHTGEK
PYKCKKCGKGFSCSSSFRKHERTHTGEKPYECKQCGKAFSYSRSFRSHERRHSGEKPYKC
QSCGKAFTCPNSCRKHERIHSGQKPYVCKECGKAFSSLTKFQRHMMKHTGDGPYKCKDCG
KLFDCPSYFHCHERTHSGEKPYKCKQCGKDFGFPCCRQIRERSHIGERPYRCKQCGKHER
THTGEKPYECKECGKAFIYPSNVQRHMITHTSDGPCKCKVCGKAFDCPSSLQTHKKTHNG
E
Download sequence
Identical sequences F1SEY2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]