SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1SF28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1SF28
Domain Number 1 Region: 94-155
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000154
Family I set domains 0.06
Further Details:      
 
Weak hits

Sequence:  F1SF28
Domain Number - Region: 297-338
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0353
Family TNF receptor-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1SF28
Sequence length 350
Comment (tr|F1SF28|F1SF28_PIG) Zona pellucida-binding protein 1 {ECO:0000313|Ensembl:ENSSSCP00000016566} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=ZPBP OC=Sus.
Sequence
MEASAPDRARRGWRRARAAGSPLSRAAVVLLLSALVLRAPPSVGYLDRLPRSFHLTQESA
KIVGSPNFPVKVYVMLHQKSPHVLCVTQRLRNFELVDPSFQWHGPKGKIVSENSTAQVTS
TGSLVFQNFEESMSGVYTCFLEYKPTVEEVVKNLQLKYIIYAYREPRYYYQFTARYHAAP
CNSIYNISFEKKLLQILSKLVLDLSCEVSLLKSECHRVKMQRAGLQNELFFTFSVSSLDT
EKGPKPCAGHSCESSKRLSKAKNLIERFFNQQVEVLGRRAEPLPEIYYIEGTLQMVWINR
CFPGYGMNILKHPKCPECCVICSPGTYNSRDGIHCLQCNSSLVFGAKACL
Download sequence
Identical sequences F1SF28
ENSSSCP00000016566 ENSSSCP00000016566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]