SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1SQ12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1SQ12
Domain Number 1 Region: 39-125
Classification Level Classification E-value
Superfamily DEATH domain 5.89e-23
Family Caspase recruitment domain, CARD 0.0000108
Further Details:      
 
Domain Number 2 Region: 147-231
Classification Level Classification E-value
Superfamily DEATH domain 5.65e-20
Family DEATH domain, DD 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1SQ12
Sequence length 237
Comment (tr|F1SQ12|F1SQ12_PIG) Suppressor of cytokine signaling 2 {ECO:0000313|Ensembl:ENSSSCP00000000974} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=CRADD OC=Sus.
Sequence
MARKGRRASGGPRGRRRSRPQRRRDWRKPCGSLVTQGHMEARDKQVLRSLRLELGAEVLV
EGLVLQYLYQEGILTENHVQEIKAQATGLRKTMLLLDILPSRGPKAFDVFLDSLQEFPWV
REKLEKAREEAIVELPADDAMAGIPPHILSSSPSDRQINQLAQRLGPEWEPVVLSLGLSQ
TDIYRCKANHPHNVQSQVVEAFVRWRQRFGKQATFQSLHRSLQAMEVDPSVLQDMLE
Download sequence
Identical sequences F1SQ12

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]