SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1STM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1STM4
Domain Number 1 Region: 3-261
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.94e-80
Family G proteins 0.0000000096
Further Details:      
 
Domain Number 2 Region: 338-441
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 2.88e-43
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000349
Further Details:      
 
Domain Number 3 Region: 238-334
Classification Level Classification E-value
Superfamily Translation proteins 2.08e-29
Family Elongation factors 0.00000783
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1STM4
Sequence length 461
Comment (tr|F1STM4|F1STM4_PIG) Elongation factor 1-alpha {ECO:0000256|RuleBase:RU000325} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=LOC100514912 OC=Sus.
Sequence
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDISLWKFETSKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV
GEFEAGISKNGQTREHALLAFTLGVKQLIVAVNKMDSTEPAFSAARFQEITKEVSNYIKK
IGYNPASVAFVPISGWHGDNMLEPSTNMPWFKGWKVERKEGNATGVTLLEALDSILPPTR
PVNKPLRLPLQDVYKIGGIGTVPVGRVETGFLKAGMVVTFAPNNVTTEVKSVEMHHEALA
EALPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPMEASSFVAQVIVLNHPGQIHAGYSPV
LDCHTAHISCKFAELREKMDRRSGKKLEDNPKALKSGDAAMVQMVPSKAMCVETFSQYPP
LGRFAVRDMRQTVAVGVIKAVEKKTATTAKVTKAAVKASKK
Download sequence
Identical sequences F1STM4
ENSSSCP00000015862 ENSSSCP00000015862 9823.ENSSSCP00000015862 XP_003129826.2.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]