SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1SUE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1SUE3
Domain Number 1 Region: 4-285
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.28e-108
Family Inorganic pyrophosphatase 0.0000000526
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1SUE3
Sequence length 289
Comment (tr|F1SUE3|F1SUE3_PIG) Pyrophosphatase (inorganic) 1 {ECO:0000313|Ensembl:ENSSSCP00000010939} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=PPA1 OC=Sus.
Sequence
MSSFSSEERSAPFTLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEI
ATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHSDKHTGCCGDNDPI
DVCEIGSKVCARGEIIRVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKP
GYLEATVDWFRRYKVPDGKPENQFAFNAEFKDKDFAVDIIKSTHDYWRALVTKKTDGKGI
SCMNTTVSESPFQCDPDAAKAIVDALPPPCESACTIPTDVDKWFHHQKN
Download sequence
Identical sequences F1SUE3
ENSSSCP00000010939 ENSSSCP00000010939 XP_001925115.3.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]