SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1SVB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1SVB2
Domain Number 1 Region: 64-367,534-569
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.68e-49
Family FAD-linked reductases, N-terminal domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1SVB2
Sequence length 611
Comment (tr|F1SVB2|F1SVB2_PIG) Retinol saturase {ECO:0000313|Ensembl:ENSSSCP00000008794} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=RETSAT OC=Sus.
Sequence
MWLSLLLLAALLLAVLGQVYKWLFAGSSPNPFSEDVKRPPAPLVTDKEARKKVLKQVFSV
NRVPEKLDVVVIGSGFGGLAAAAILAKAGKRVLVLEQHTKAGGCCHTFGKDGLEFDTGIH
YIGRMEEGSFGRFILDQITEGQLDWATLSSPFDIMVLDGPNGRKEFPMYTGKKAYVQGLK
EKFPQEEAAIDKYIKLVKMVSSRASHAILLKILPLPLAQFLSKYGLLTRFSPFLRASTQS
LAKVLQQLPASPELRAVLSYIFPTYGVTPSHSTFAMHALLVDHYLKGAFYPKGGTSEIAF
HTIPVIQRAGGAVLTRAPVQSILLDSAGKACGVAVKNGQELVNIFCPVVISDAGLFNTYE
HLLPEKARSLPGVQRQLGAVRPGLSIFSVFICLRGTKKDLGLWSTNYYVYFDTDMDKAME
HYLSLPRDKAAAHMPLLFIASPSSKDPTWEDRFPDRSTLIVLVPTSYEWFEEWRDEPKGK
RSSDYETLKSSFVEASLSVVLKLFPQLEGKVDSVTGGSPLTTQFYLAAPRGACYGADHDL
SRLHPHVMASMRAQSPIPNLYLTGQDIFTCGLMGALQGALLCSGAILKRNLYSDLWKLGS
KIQAQKNKKKN
Download sequence
Identical sequences F1SVB2
ENSSSCP00000008794 9823.ENSSSCP00000008794 XP_003124992.1.46622 ENSSSCP00000008794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]