SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1T0H3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1T0H3
Domain Number 1 Region: 90-155
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.22e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1T0H3
Sequence length 237
Comment (tr|F1T0H3|F1T0H3_HUMAN) Neurogenin-1 {ECO:0000313|EMBL:BAJ84047.1} OX=9606 OS=Homo sapiens (Human). GN=NEUROG1 OC=Catarrhini; Hominidae; Homo.
Sequence
MPARLETCISDLDCASSSGSDLSGFLTDEEDCARLQQAASASGPPAPARRGAPNISRASE
VPGAQDDEQERRRRRGRTRVRSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLP
SFPDDTKLTKIETLRFAYNYIWALAETLRLADQGLPGGGARERLLPPQCVPCLPGPPSPA
SDAESWGSGAAAASPLSDPSSPAASEDFTYRPGDPVFSFPSLPKDLLHTTPCFIPYH
Download sequence
Identical sequences F1T0H3 Q92886
ENSP00000317580 9606.ENSP00000317580 NP_006152.2.87134 NP_006152.2.92137 ENSP00000317580 ENSP00000317580 gi|38455396|ref|NP_006152.2| HR6466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]