SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F2CY76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2CY76
Domain Number 1 Region: 336-474
Classification Level Classification E-value
Superfamily ApaG-like 4.19e-29
Family ApaG-like 0.00038
Further Details:      
 
Domain Number 2 Region: 126-237
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000119
Family SMI1/KNR4-like 0.01
Further Details:      
 
Weak hits

Sequence:  F2CY76
Domain Number - Region: 53-107
Classification Level Classification E-value
Superfamily F-box domain 0.000556
Family F-box domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F2CY76
Sequence length 474
Comment (tr|F2CY76|F2CY76_HORVV) Predicted protein {ECO:0000313|EMBL:BAJ87797.1} OX=112509 OS=Hordeum vulgare subsp. vulgare (Domesticated barley). GN= OC=Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum.
Sequence
CLSPPSPVPPPPSPPPPTHRATLMASPPTGPAAPAGLESMEGLALDTIIAKAGARPAAAL
ACASTHLRAAVAEDAVWRSFCSRDLGLDAPLDPEDRPLPSFKDAYKVWSESFGMYPLPLV
KRVKLFWSSLKSWISENFPEALRTLSKGASEAQIRSAEDDLGFKLPMPTKLLYRFCNGQL
PFSKNHFENIRMAPLGIIGGYVFYDHNVNVHLSSLEQMVEETKEFKFKLEDEGVPIGANL
ALVASSWYHPKTFLLNCSSGELYVGTANLSAGEMMPCVPKSLVKPTNSDMPQDGLLLWLE
EHLRRLQNGMIKIRPLKTSRYICLYPEASPLCSSAVTNGVKVRASAVFAPEHPHGVGRVG
IYLYSYSIRLSVPEACMLGGVYFSSCQLHSRHWIIRCGDRVVSDVHGEGVIGEYPLLLPG
QDEFVYESCTPLNGSSGSVEGSFTFLPGRVTRPEGKPFNVTVAPFTLEVPDYIF
Download sequence
Identical sequences F2CY76

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]