SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F2EKM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2EKM1
Domain Number 1 Region: 96-161
Classification Level Classification E-value
Superfamily HMG-box 2.23e-19
Family HMG-box 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F2EKM1
Sequence length 215
Comment (tr|F2EKM1|F2EKM1_HORVV) Predicted protein {ECO:0000313|EMBL:BAK07893.1} OX=112509 OS=Hordeum vulgare subsp. vulgare (Domesticated barley). GN= OC=Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum.
Sequence
MATAGNAPRSRKRVEATVLKRARDGSAFTRCEACNKDVAIVLIDLHSCSLDSKIRLSLES
QVVEKAVEVQEKKRKAPPAAAGGKGKKKSKADGDGAKKAKAKRPPTAFFLFMKDFRVEFK
TSHPDEKGVAAVGKAAGEKWRSMTEEEKKPYNDQAKELKAQLDNGEGSAENNVGDEEKAD
ADAEEVDDADLEVDKQEDAPEDEEEEEKNELDDDI
Download sequence
Identical sequences F2EKM1
MLOC_77667.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]