SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F2L5W0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2L5W0
Domain Number 1 Region: 41-224
Classification Level Classification E-value
Superfamily vWA-like 5.5e-28
Family Integrin A (or I) domain 0.016
Further Details:      
 
Domain Number 2 Region: 428-502
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0000000202
Family FHA domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F2L5W0
Sequence length 509
Comment (tr|F2L5W0|F2L5W0_THEU7) Uncharacterized protein {ECO:0000313|EMBL:AEA12405.1} KW=Complete proteome OX=999630 OS=Thermoproteus uzoniensis (strain 768-20). GN=TUZN_0922 OC=Thermoproteaceae; Thermoproteus.
Sequence
MVRLGDLEVDLYANNTPDGYLDVEVRLSARGRGPAPETNTAFAILIDKSKSMADFDKLAH
AIEAAKGLVESMAPEDIVAVYVFDEKVKALVPPTPVEKARKMLGKIEKIKPGTYTLLYQA
LLQVIDDLRGIKRGLPLMPRRAVPENIPKRIVVITDGEPWPYYTEERWYEHLGKAAARYG
ITISAIGIGDDYNEKILYALANSSGGAWYHISQIRDISQVLANELRRAKTVVARRPKIAV
EPSGAELVDVRKIGAVVSRLPVSKEVELEDVAAGDVISAVFRFKTTSPDYRVEVSVTTDA
GTYRDVVTSDKLTPDRTATLTLSMAQELEKLAEGGVVSVEVLRAVSETPTAPEPLRRKAQ
RLLEAAPSGEGKEAFWEATVTLTLPVEEQQLEATAEKPAPQTPAPQQAGKCVLTCIETGK
SMEVPIPALLGREDLQQIIPPEKVPYISRRVGERAHLAIYRGEDGIYIKDAGSKGGVYVE
GKKVAEPLRLAQGAVVNLAGVVNIRIECS
Download sequence
Identical sequences F2L5W0
gi|327310820|ref|YP_004337717.1| WP_013679741.1.87035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]