SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F2LV85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2LV85
Domain Number 1 Region: 324-472
Classification Level Classification E-value
Superfamily Nucleotide cyclase 4.94e-48
Family GGDEF domain 0.0000509
Further Details:      
 
Domain Number 2 Region: 194-316,445-469
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000167
Family FCH domain 0.077
Further Details:      
 
Weak hits

Sequence:  F2LV85
Domain Number - Region: 63-174,216-267
Classification Level Classification E-value
Superfamily ARM repeat 0.00345
Family MIF4G domain-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F2LV85
Sequence length 481
Comment (tr|F2LV85|F2LV85_HIPMA) Diguanylate cyclase {ECO:0000313|EMBL:AEA33669.1} KW=Complete proteome; Reference proteome OX=760142 OS=Hippea maritima (strain ATCC 700847 / DSM 10411 / MH2). GN=Hipma_0699 OC=Desulfurellaceae; Hippea.
Sequence
MLRKPKSGKTHCSVYIENLSTAIIHLLIALKANDEAIDSQIDKFKEQVKKIKFEENPSKV
IALRDSIADFVIKYDEYIHQKRDEFNKLLLSNISILITLAKSSEADTRWKNSLDEVKELL
KNKIDIEQLKKTKDILFKLGTATKDSKDIVYRDIVNILFELLDLETDSPDAKPYLEKVQK
LQTKLSSSPYRLDEKEIRDEIKSIVEEKERLEEEYIESLQKKLDKALKALIYTITTFTTS
SNNYVNTFEGHIEEINNTIKNGNVDVDELSKRLIGIAIKIKDTTLNMKNELEEYSKKIDE
AKKTIEELKEKLKKAEENLIIDPLTGVYNRRGLLHFLKIEIARAKRYKQPMSIIMADLDH
FSRVNNTYGHLAGDIVLKGFCKTVKSLIRATDIAARYGGEEFIIILPNTDIDSAYEVAEK
IRNAISKLKFKYKDETFSITSSFGVSQYKDDETIEKLIKRADAALYKAKEKRNITVKESQ
I
Download sequence
Identical sequences F2LV85
WP_013681710.1.98252 gi|327398859|ref|YP_004339728.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]