SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F2PJP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2PJP7
Domain Number 1 Region: 421-488,518-567
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000602
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F2PJP7
Sequence length 583
Comment (tr|F2PJP7|F2PJP7_TRIEC) SAM and PH domain containing protein {ECO:0000313|EMBL:EGE02115.1} KW=Complete proteome; Reference proteome OX=559882 OS=ringworm fungus). GN=TEQG_01154 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MDYTYIPPLSQGSIQMFPPVNNKQTIDYMMRRSSFNSRPLSEATEIQDLDYEVEYSEPES
PRRSIESFGTDSATTLSLSDEPPTPGPYEARTFELPSRNSKQLLPKPHKCSKGENCSKYQ
KRQRKLARIAKQFPNEFALIDGELVATTNQVVPPTPAMTQISRKSDAAPSLVASSDVLGP
GLLPDLHPELQLNAENLNGVRPRDPQENVRQFLTFQHMHSPDLNSASTNQPLEMFPPLPS
QEPPIHVSNQLRSLPKLTIPNQTQSVSDPTSALRTVTPSMGARVVNSPTATQEYNPYAFD
DNNTYRHGTPFSEMDVPITAVPVEPLAREASQSVPPGMRYGNIPTRQHQTPEPPVRSRST
RPERHRRHPSVNTMTPLHEIENLSPIENPSDMDAATKPQPPVTHQTGSTGSSSSSSAQKD
PDVTHSGWMKKRRTTRLLRHEWQDAHFTLKGTILAMHKDEFDTHRHSRALESIDVDDYAV
ACSSLASNSKLTAAFKRSVLRKAANLNNNSYKGMDETAFAFSLIPATKPSERKSIFTANG
KNHHFAVKTRDERINWMRELMLAKALKKGKEAGNKIKMNGNFI
Download sequence
Identical sequences F2PJP7
TEQG_01154T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]