SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F2PTR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2PTR1
Domain Number 1 Region: 138-258
Classification Level Classification E-value
Superfamily PH domain-like 0.000000632
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F2PTR1
Sequence length 1282
Comment (tr|F2PTR1|F2PTR1_TRIEC) PH domain-containing protein {ECO:0000313|EMBL:EGE05279.1} KW=Complete proteome; Reference proteome OX=559882 OS=ringworm fungus). GN=TEQG_04435 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MGRLRVPSFLSSRPDGPKGKTAAASVSFSTPDLPGAVTQTPSNQPPAAGAGPAPDQEQQT
SASPFMRRTRRLSRPIASLWTQKSAQSENEDRNQNQNLSQSQSQSESQTAPSSPPFDAEP
LVVPELEPVFAYLNNQANKLYQEGYFLKLNDLDTQGQACPDRQWVECFGQLVGTVLSIWN
ASALDTAGGQANASPSFINLADATIKMMETLPTNNETNQPLQNVVSISTAGKNRYLLHFD
SLHSLTQWTAAMRLTVFENSLLHESYTGALIAGKGKYLNGIKLILEKTTFKYEDWARVRF
GAGTPWRRCWCVISPPGEKEMQLYNRSLKKKSAYDRAPTPPKGNIKFYETRKTSKKVAPI
ATISDAYSAYAIYPQARPLVDQSTLVKVEGLVTIGENTSDGFVFVLPEMHNAVSGFETMI
RWLFPAYDAFRLYGRPNRLLADTVSPNSLMFAMPSNKRRGYLDILDVSALIHTQGSENWS
AREWRKQLKDATSRRMTSNAGSSRTSSVSGRRSGKRSSLPQRTGTVRFGSATVGPRNGEP
NSSSDTVASNSPTKPGISHTRSESENTGLPSARRGRRSPPFFENNIGEDIPEHPPAPPPE
LPQTDGPSEVDGTDSRSSPDSGAYMDNTRPADRLDIIQSLEPNPPPQGVPVSPAFSHDPR
GTPQFKPQPSPEIGHAANRMSVGTLDQLVDMNKKNGNSHGLAVAGATAAWNAATDNSKET
DNGTGQRADPRGPTLNRLNSIGASSSNYSQGSPITPSDTTSNVNVGVNINITDTPTEGQF
PVKQQNGTQNPPLHKPIARKPVAAEIPIAETASVRTASTLGSLRDNIDMDALDRIIRRPR
SPSPPPPPQPKYTFKQETAVQDDASSIVAPSYASSHKSSPSVRSIQSVQKPRMGKMKVVG
DAMPKTDDLVIGDARYKHPAVTPVEVSSDIPEVDFGPTHTYKPTARRPGTSDTMLLLSSS
HQRNPSEGTLATRGRRLSTGRLLEHLNQESNESPSPPPPTQERGRRRSVLWQPGMVQDSG
PVTPGPTSISAEQFVHDRASRSQIHLPVMPTRATPPPPRPASGDWSAYIRHQSSATHLPQ
RPHSRGPSVMLDMPARPSSRGANTILDVPARPSSRGASVILGPLDAPARPSSRGANRMLS
QPDISGHLSAREQEHVARVTGSSFLNLNNNQSPQFGSGLVSTIDARERERKAMKDGFSGQ
AVQQAIAQRQYQAQVQAQAQAQAQAQAQFQLQQQFQQPLGTSPGYAASMQFPYLPQQQPQ
QPPQAGYYAPPQGQQWQPQYHA
Download sequence
Identical sequences F2PTR1
TEQG_04435T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]