SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F2PXF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2PXF6
Domain Number 1 Region: 1262-1396
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000171
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 
Weak hits

Sequence:  F2PXF6
Domain Number - Region: 37-87
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0241
Family Myosin rod fragments 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F2PXF6
Sequence length 1563
Comment (tr|F2PXF6|F2PXF6_TRIEC) Anucleate primary sterigmata protein A {ECO:0000313|EMBL:EGE06574.1} KW=Complete proteome; Reference proteome OX=559882 OS=ringworm fungus). GN=TEQG_05572 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MDDPFVATPLAAVQSQREPHRYSSFDNQLLTLNSSSPSQLKRALEIHLAETDRRLEETSR
LGTALVRQQQELADKLKEVEQQEDEGEIGPELREKLLALERDYNEVGRESARTTFGAKPR
LLAPEDTPLDSRTPSSPAFLSSQATNSPSKVSVPSRRQRNQPASRIHDIEFATEISTSLL
TQVRQLQALLAERDEALRETNLEKSRLELEAEGFSQRIRSLDESEQRYKDENWRLETQSH
ELMAAAKEAAARENRLTANLNALTAKKNSVQRELDELKQANGKLMEEHSAAQKAHDSELH
ILRRNLNTGDAERNNLRKKVDELVGQNQELAKAVAAKLRQHESEPARNVDTETKNNDDDE
DTPENSPPPSPNKATPRHGHLESETLKSSLHHAHRMIQNLKSSIHREKSEKIELKRMLQE
ARDDLEARRNEIAAAQGSSQKRHKTKAEIFKKPPRPDMLGAGRRGITEIELDEPDWEDEE
VMEPSPTKTVRPRQTSVVYTRPRPRPRSGYVSASDAYQTANETEDGGFETAHETETATES
ENFQTGTEDMAGDSSDELTETEGRAVGQTAMPRTKPYKLRNAKAGDRSSFMSTASTSADE
DDYPYNEVHTPVQSHPPRYRLKMQRGRHARSSEETIQAGGSIGYETQSPGGSLHTPKSRV
EGGRSLFAELGEAGMGSDGEFGSPLQQPNNNPVSAESTPIRNLSCLQNKDADQPPRVAMI
DSSMMTEPWPAPAPASGTVATQTLAPQTANATTSTTSAVLVDSSTQSIVSKRPPITQTEA
MVVFSTLPSEPVKSVDMATQCSPVKSQPMAQTGPVVIHDTPPAEPSKSTAVDMATQYASA
KPQAMVQSEAMVMFDSPPVATPAEDRSRDIIAPIPVPLPITSSSPDPEPAPEPIKLEHSP
IMFEETTPVLPPVVEQPRRSSMHLAYSDVTFEQSRPVTPLPIPAALPVPCTPPKYMASSI
QTIDTPPISPPTEPEVVKPFIQLEMSSIYAESTTPVIPEPVPTIIPPVVALGTGSETEMS
PRRPRTAVHDKDTEAPSPLESSREIMPPPKFVTEGTGSMKSKQPLRLFAPASVTENGAQT
ILTSKQIDSLLLDKYVMPPPKTPESRALAPAFPGSLEEAALATPRAKTQPSSANDNFLLP
NAAAKRPGSAGSRRSTMVHPPLPPDHKQAIAAAAQRLSTESPTGGAGTMGPPVAPASAYR
SGVPASRPRTPNEQATVTTAIQGSNGSKTQHKHSGAASRRSSISSFASELDDRFNLSRSE
YGFEPGTDPRMIQAITQTMIGEFLWKYTRKPGRPDFSQTRHRRYFWVHPFTRTLYWSTQS
PQTASKAQLMAKSVAIEAVRVVTDDNPYPPGLHRKSLEVVTPGRTMRFTAATSQRHETWF
NALSYLLLRANEEEGDFVLHSTPEDGPLDFNPSLNGRSSRMTDYSRRSAASHSSRAARGM
ARGYDITPGHESPSLSVRPPDTTMKAEQARQGSVSRLSSMFKTSGMMGTFSSRRSRYGGK
RGSVDDTSQEDSAEDLRRILERQEREADKIENVRACCDGKHDVGSLSRTSRFVNSRLSNH
SHS
Download sequence
Identical sequences F2PXF6
TEQG_05572T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]