SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F2QXZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F2QXZ9
Domain Number - Region: 199-276
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0262
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F2QXZ9
Sequence length 374
Comment (tr|F2QXZ9|F2QXZ9_KOMPC) Uncharacterized protein {ECO:0000313|EMBL:CCA40277.1} KW=Complete proteome OX=981350 OS=Y-11430 / Wegner 21-1) (Yeast) (Pichia pastoris). GN=PP7435_Chr4-0101 OC=Saccharomycetes; Saccharomycetales; Phaffomycetaceae; Komagataella.
Sequence
MTTVSFQKIMVFPRIAIQDILNYDTPNCIVPMSGSSSASNSIDTGTESVSTEGEPGGSPD
GMEGEKESNTDPEGAEQLDPSSQYRYSFEVSLPYFSKLVLARKCHQLSKHTANTKFSNKI
SSQNGKRGRPYSLLINARLMVYSDLQSILSSLHKSLYDIHEYDMRNIPAVCKSPSSPAPT
EQDQLLESISRLLGCSSSLFDSHVVANTNFRALKYDCKNNSMSFLQYMDKIVQSEKYKFV
KTIRDYNGKLVKLEIIDKPNFHSNLKNMEWLKEHACFPRYKANMKIHVMLHEDTQDSNSC
ASDDSEILFYNEPRLFLHDLIYNNYGISKEDVPDLLRGSVSHLRLRLGYWADKRVLINRE
NFTEHLSSFLHHDY
Download sequence
Identical sequences C4R944 F2QXZ9
644223.PAS_chr4_0851 gi|254574378|ref|XP_002494298.1| XP_002494298.1.19831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]