SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F2RYH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2RYH4
Domain Number 1 Region: 105-243
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-48
Family Ran-binding domain 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F2RYH4
Sequence length 250
Comment (tr|F2RYH4|F2RYH4_TRIT1) Ran-specific GTPase-activating protein 1 {ECO:0000313|EMBL:EGD96373.1} KW=Complete proteome OX=647933 OS=Trichophyton tonsurans (strain CBS 112818) (Scalp ringworm fungus). GN=TESG_03821 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MADEQKTDPTTTAPPEAVTEDKKEETTATEKTGEDESKKAEAEGEKADKPAAAEESKPAT
TDSVFSMFGGGPPKEKKEQEDDADEPSGSSKKKTEGDDEDPEAEPDVHFEPVIRLTEKVE
IKTNEELEEQTFKMRAKLFRFDRESKEWKERGTGDIKLLKHKENHKTRLLMRRDKTLKVC
ANHYVVPDMKLSPNVGSDRSWVWNAAADVSEGEPEAQTLAIRFANSENAALFKEAFEKAQ
EENALLFGKD
Download sequence
Identical sequences A0A059IZ14 F2PUN2 F2RYH4
TEQG_04609T0 TESG_03821T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]