SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F2U0I9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2U0I9
Domain Number 1 Region: 246-339
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000011
Family Cadherin 0.0098
Further Details:      
 
Domain Number 2 Region: 99-131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000188
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 344-440
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000127
Family Cadherin 0.013
Further Details:      
 
Weak hits

Sequence:  F2U0I9
Domain Number - Region: 491-545
Classification Level Classification E-value
Superfamily Cadherin-like 0.00134
Family Cadherin 0.0061
Further Details:      
 
Domain Number - Region: 201-243
Classification Level Classification E-value
Superfamily Cadherin-like 0.0106
Family Cadherin 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F2U0I9
Sequence length 565
Comment (tr|F2U0I9|F2U0I9_SALR5) Uncharacterized protein {ECO:0000313|EMBL:EGD80917.1} KW=Complete proteome; Reference proteome OX=946362 OS=Salpingoeca rosetta (strain ATCC 50818 / BSB-021). GN=PTSG_01501 OC=Eukaryota; Choanoflagellida; Craspedida; Salpingoecidae; Salpingoeca.
Sequence
MTASRRRTQRGRDFEDSVVYSCHSGNVVYNTTSGSTLTTLLPPDSTPAYMTSFTRTCRAD
QTYTNTELACRDVNECDPDAYAAYTAATGNSAQQEQSFSTACQDACTNTIGSFECSCPAG
FELQADGRSCDVLSCGLPPSRPFATVASQDQPRTYQQQALYTRRTWWSWLRCWRASRSCL
PHHNDPCTASGETQPQQQLVLVDAQPIDFEASQTFDVTLACSDGNGGATDATFTLTVQDV
NEPPTAIALSSTQAAEDVPVGSTVASIIVVDQDAGDTHNVTVASEPAGVFEAVRNPSTGA
YALVLASPLDFETQDSVAVIIRAEDSAHNVLQTTITVSVLDANDPPSAVTLQPSSLNEHS
AAGTVVGIVSATDQDDPSATTPITIHVLAGHNSGLFEVQPINTSSPQQQQQLVFVGAPDA
IDFEVSSVVEVDVQAEDSEGGTRCTATLSTTFAAANAPNYEETPFVDVVVVATDLLYTVF
NTFNITILNVNEPPYLLELSTSSVAENTPPGIPIATIVAFDEDRSGDEHTCQLLFGGDSA
LLSLLPPNTLTVAAGATHGRRVCCV
Download sequence
Identical sequences F2U0I9
PTSG_01501T0 XP_004997478.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]