SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F2UB42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2UB42
Domain Number 1 Region: 333-519,669-832
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.34e-41
Family beta-glycanases 0.00053
Further Details:      
 
Domain Number 2 Region: 46-214
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.05e-31
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.0018
Further Details:      
 
Domain Number 3 Region: 239-335
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.0000000000576
Family beta-Galactosidase/glucuronidase domain 0.0035
Further Details:      
 
Domain Number 4 Region: 962-1028
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.0000331
Family beta-Galactosidase/glucuronidase domain 0.0095
Further Details:      
 
Weak hits

Sequence:  F2UB42
Domain Number - Region: 557-614
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0298
Family Hairpin loop containing domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F2UB42
Sequence length 1034
Comment (tr|F2UB42|F2UB42_SALR5) Uncharacterized protein {ECO:0000313|EMBL:EGD74055.1} KW=Complete proteome; Reference proteome OX=946362 OS=Salpingoeca rosetta (strain ATCC 50818 / BSB-021). GN=PTSG_05747 OC=Eukaryota; Choanoflagellida; Craspedida; Salpingoecidae; Salpingoeca.
Sequence
MLKGVVKMLWVAAALVVVAATAGAAVASENGNDDGLKDHPVVGTASYSLDGTWVATAHGS
SQSYQVIAQVPGDLISDLERQEYIGNPLYEVNFLNSTIWHSYNWTYTRNISLPGLNQGER
YMLVFDGVKMGATAYVNGHRVAVMTDQFLRYTVDVTQWARAGYNDIAVTFDPAMDVNGRF
MACTGGWDWAFYTNTANHGCSTFTKGIWKSVYIVKAAPVAVTHLVPHVFYNGSYPNKPLQ
DDNHGDFEVHVKVFFWTHAAQHVSITATGEWGATASTSVVSEPGDNVHMLKLRATAADID
LWWPVGMGDHPLYTVTASVSAGGAPVTAQRNIGFRVFALVTGNDTNPEYVKKNMHADGTD
TQGMLFRVNGAAIYSRGANMIPMEELEGRLNGTAHRQLVQSAVDGGMNTLRVWGGGIFLP
DAWYDACDRLGVLVYHDMQYAQRGHSPTNDSTQTAELQHQIRRLSHHPSIVIWDGCNECH
VVIHTPTGIYATFVMTLVAAEDASRVIWPSCPAPGWTNGVNRLTGLPNGSPLGLLPRATP
PPSSSSSSSSSSLCRFQENTDYEAGTVWTHPTASTQETCCGECSRNSTCDIAVFYESTCW
FKRNTSAPSYRQGRTACFPPGAGPIPTPQPAPPSPGNIETHGPYQHGSGFPAMNGSPQLQ
LFDANIPISLTPYLTGPQYHSVYASEFGCVVMSSFESMAPTLAKEHWGLHGGAPPDNCTG
GFSPVCHGDNVMAQRNYPCDSIVLVYFGEQDLNATGADAFKKQLYMCMIGQALNIKSNIE
TRRGTNQFGTLIWQLNEIWPTGGWGSLEYGTPGQPGQVIGGRWKPLHYWLKSSIYADTMA
ACDGAGVCYIKNDAARAFTGRVTVTAVPFNGSPSSVLKALDVSLDAGAGVTQWFTVDLSS
INYNSTVLLIEVADTTTTAAAAAGANDDGDSGVIVSSNVQALTPPQYMQLSPADVSFTVA
DTASSDGTIDITVTTTAPAMYVTLTTLAQGRFSDNAFLLTSTKVVQFIPFLPTTPAQLKQ
SLRIEHLQQYTAHA
Download sequence
Identical sequences F2UB42
PTSG_05747T0 XP_004993617.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]