SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F2UCW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2UCW4
Domain Number 1 Region: 225-345
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000211
Family Pleckstrin-homology domain (PH domain) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F2UCW4
Sequence length 374
Comment (tr|F2UCW4|F2UCW4_SALR5) Uncharacterized protein {ECO:0000313|EMBL:EGD74459.1} KW=Complete proteome; Reference proteome OX=946362 OS=Salpingoeca rosetta (strain ATCC 50818 / BSB-021). GN=PTSG_05823 OC=Eukaryota; Choanoflagellida; Craspedida; Salpingoecidae; Salpingoeca.
Sequence
MAGRPQDARLKKLLTAFNVLDHWPKLEQRGVRNVFALAKLSDQELVGLLHLDQSQLRKMR
AVLTKLEAARAQHRGEQQQKRASANPQRKSQQSEQQQQQPQQHRGPAGVQRRSHAGTAAA
AASSSSSSSNRNSRVLNLAPAPGFSGPIDGALHRVPSRTQRGPPSRGSGGLPAGTRQSRK
SYDMRSPPKKASSSSSVKTRSRPSKAAQYTAQPLRRSLWDFDFDVDVLPTVVCECWATKC
GGKVKSWQKRYFVLRNDGSLTYSKEGALSDHKGVIDVRDATVINGPGSCNWLKEDGAPPA
AEPSKRVEIVTPVRTFKLFCDTQADATMLHSKLQEVWKYCKRAKKRAPLTERDIAGGEGY
QRMLAEVAHVMTAQ
Download sequence
Identical sequences F2UCW4
XP_004992716.1.12839 PTSG_05823T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]