SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F2UD74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2UD74
Domain Number 1 Region: 145-353
Classification Level Classification E-value
Superfamily YWTD domain 0.000000314
Family YWTD domain 0.024
Further Details:      
 
Weak hits

Sequence:  F2UD74
Domain Number - Region: 326-425
Classification Level Classification E-value
Superfamily NHL repeat 0.00204
Family NHL repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F2UD74
Sequence length 441
Comment (tr|F2UD74|F2UD74_SALR5) Uncharacterized protein {ECO:0000313|EMBL:EGD74569.1} KW=Complete proteome; Reference proteome OX=946362 OS=Salpingoeca rosetta (strain ATCC 50818 / BSB-021). GN=PTSG_05933 OC=Eukaryota; Choanoflagellida; Craspedida; Salpingoecidae; Salpingoeca.
Sequence
MASVLRAAPVLVPVLVLVLVAAACNRCNLQQHACPCMCAAEVVFAEDDAGALHINTSDPM
SQPVLVNGVNMGAVFDAVAAQQSMLQAYQSVMDTQQSRISMQQSRIAVQQDRIAALEAEV
CTPSTSVFGQLSGASNKWVGGALAGNGLIYAAPFNADSVLILNPTTNTADVTSIAGFTSG
GGKWAGAVLAENGLIYMFAASATSMLVVDPETNNVDVTSIHSLPSGALKWASGVVADNGL
IFAIPYAFPSVLIVDPATNITTTIALDGLSGSGTEWYGGVQAANGLIYCFPSAATFVLII
DPIALTADTTSIQGLEAGAYKWLGGVLARNGLVYGIPARAGTVLVIDPTTNSIDMIRIAN
STITSRWAGGALAANGNIVCIPYSSTPALIFNPATNATTMVAVPDVGEGPVGWWDGVLAP
NGRIYGLPLFPEVVLAIDPGC
Download sequence
Identical sequences F2UD74
XP_004992826.1.12839 PTSG_05933T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]