SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F2UI87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2UI87
Domain Number 1 Region: 26-77,124-349,447-486
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.48e-63
Family Type II chitinase 0.0000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F2UI87
Sequence length 528
Comment (tr|F2UI87|F2UI87_SALR5) Chitinase {ECO:0000313|EMBL:EGD76836.1} KW=Complete proteome; Reference proteome OX=946362 OS=Salpingoeca rosetta (strain ATCC 50818 / BSB-021). GN=PTSG_08183 OC=Eukaryota; Choanoflagellida; Craspedida; Salpingoecidae; Salpingoeca.
Sequence
MHATLLVCVILACTAWSAHAMVFGNYFANWAQYRLGNYAYTPKNLAPVADKFDYIVYAFA
WMNGGCDGCKGDTVYDWIGQCQYSNGTCAMYSNGTRDAPECPMGASPCTANNFTLVSPEP
ADPQFYEQVVAFKNDNPDLKILLSVGGWNFPSSIFSEMVASKESRTAFIKSTQEFMDKYN
FDGIDVDWEFWCSGPRSDHIKLSNKSFHNLYDVGGKCPDDGQNLLTLVTEIRSAYGKDKM
ITLATQADLQKMESIDIKAVSEQIDYWHLMAYDYSVSDLPEMCGDAPCFANFTAPNQPLY
AVKEGQIPKHDPPFPSSFWSVNYTVQGYLDKGAPADKLVLGLTFYGHSWYIPNQSNWKRF
GVPAALSHACYGPFNPTFGAWPGARARLCGLLIYSEIVALIDETDPEQNFFDPATQSDIG
YIKDGSRAGEDLRNATPGYVSWNSIRSLSAITNYAKKQGIAGVFAFDASMDVFVDKSYPV
VNAVYNITSGGKPGSNQCDPSKGCNVCSACCKSYIKVRSGVYGACGVL
Download sequence
Identical sequences F2UI87
PTSG_08183T0 XP_004991208.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]