SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F2ULF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F2ULF4
Domain Number - Region: 39-250
Classification Level Classification E-value
Superfamily NHL repeat 0.00889
Family NHL repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F2ULF4
Sequence length 366
Comment (tr|F2ULF4|F2ULF4_SALR5) Uncharacterized protein {ECO:0000313|EMBL:EGD77953.1} KW=Complete proteome; Reference proteome OX=946362 OS=Salpingoeca rosetta (strain ATCC 50818 / BSB-021). GN=PTSG_09586 OC=Eukaryota; Choanoflagellida; Craspedida; Salpingoecidae; Salpingoeca.
Sequence
MMLTMVVDGMTRRVAVAVALVVLVVSVSCPRVVVGSLQGLYAMEGGSGQLQRVDWRTGTV
EKVGPSLQSKGWHVADCTPSDVDRTGKWYFALAKPVSRNDSSTPDAAQPWTLIGMLLADA
TIRTTQQLPDLFDPGMDACEHTVSVNSGWDAIVTAVTGKHTADPRLSVVLFNYTLATTRQ
TRVLVNESLAAIGLGGPAKHPATTFVTATGSLWVQLEQGLVECYLTNGSCARTLPFAPQQ
LLTGLQYQPSSFVYGVLVPPPSRNAAQLQTAQPAAQTHALGAFDPISMAPSITRITLSSP
VTVAHGGTAMALLSDQAKVVLLTTGGDLVTAHINGTVASTVKLCSPSANVSLPACPASMV
YEPFVF
Download sequence
Identical sequences F2ULF4
PTSG_09586T0 XP_004990016.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]