SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F2ULL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2ULL1
Domain Number 1 Region: 212-470
Classification Level Classification E-value
Superfamily NHL repeat 0.00000000759
Family NHL repeat 0.027
Further Details:      
 
Weak hits

Sequence:  F2ULL1
Domain Number - Region: 153-237
Classification Level Classification E-value
Superfamily NHL repeat 0.00154
Family NHL repeat 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F2ULL1
Sequence length 477
Comment (tr|F2ULL1|F2ULL1_SALR5) Uncharacterized protein {ECO:0000313|EMBL:EGD78010.1} KW=Complete proteome; Reference proteome OX=946362 OS=Salpingoeca rosetta (strain ATCC 50818 / BSB-021). GN=PTSG_09648 OC=Eukaryota; Choanoflagellida; Craspedida; Salpingoecidae; Salpingoeca.
Sequence
MVVLCVLQRVGFGHTVAIPSHPPVLTTAPAEHNGTTVVASATSATTASRTARTQHTSPQH
RSSIHARIPCFAALAAVALLTLAVGSLAGSGRASLTQDANGTVHLRTSDPSQRVLVNDVD
VLGVLRELQSQQGVLDTLKVRMCAGVDALATIGGPFTAPYSDVVAAPNGILYGIPSVGDE
VAWINPRTGQVGTVLIRNINWASSLYWASGVLASNGKIYGTPAKAQFVLIIDPATNTVDV
STIEVPVPPVDPQNAQWAGAVLAPNDKIYAVPRHGTSVLIINTKTNLADVTTIASVSTPL
QTDQWHAAVLAHNGLIYGIPLSASSVLIINPATDTADTTTLANVGSGMKKWLGAVTGQDG
RIYGIPYDSPHVLVIDPSTNTFDTTSVATNFMAGGDKWAGGVLLDDGHILGMPRAAQSVL
LIDPSTNTTDAASLALGMLGSETELQWSAAALAVDGKVYAVPLQIDDVLVIDTFCML
Download sequence
Identical sequences F2ULL1
PTSG_09648T0 XP_004990072.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]