SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F2UP69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2UP69
Domain Number 1 Region: 337-388
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0000000000718
Family Fibrinogen C-terminal domain-like 0.0012
Further Details:      
 
Domain Number 2 Region: 76-130
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000778
Family Complement control module/SCR domain 0.0047
Further Details:      
 
Weak hits

Sequence:  F2UP69
Domain Number - Region: 140-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00193
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 275-334
Classification Level Classification E-value
Superfamily Colicin Ia, N-terminal domain 0.0772
Family Colicin Ia, N-terminal domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F2UP69
Sequence length 560
Comment (tr|F2UP69|F2UP69_SALR5) Uncharacterized protein {ECO:0000313|EMBL:EGD79424.1} KW=Complete proteome; Reference proteome OX=946362 OS=Salpingoeca rosetta (strain ATCC 50818 / BSB-021). GN=PTSG_09992 OC=Eukaryota; Choanoflagellida; Craspedida; Salpingoecidae; Salpingoeca.
Sequence
MRLVVRWLLLLCVLVVVAPAQVAVVSAAGDSAACVALGAASSCVELNRNACSGAGAGSGD
CGSCFDGYAASNQSTTCFPVSCGTPQPTSNANPESTSELFFGDTVTFSCNPGTRASGDAD
SYDVQCTADGTLEPVVSGQSCQDVDMCAGSPCGEQLCEETANGLDFICRCKPGFAGTADH
EGNGCFVPEMAVVDGTLEVLAEDVVLNLPEQPEFTSLRSLVQQLSTALETEVTTARDNES
RNQDNILALQQLLAELGANFTALNGRQEDTSAFAAALAQQITDERNRATAAENSISQAVN
GLAGDLNDLSGRVDNVAALPDEVQALRDELSQLKLLLVPKSCLDVKNINPSAQSGIYEIR
PAGFTRKATLDVYCDMETDGGGWTRTAHLNDQQITEFPVTDANAMVDASSLGYNSFSGLW
FNTQPTTQMLIHYAGGGGAAYGAGEHVRITWGDDPMTYGVYNNHRLQDCRNLEQNVAWSS
CQYSSHQDATWQSCSFSFTWGGLNNMYGGNQQYRVILGPTARHNGGGDCFWHNFGANTND
RNNANDWAGAPDKEGYIYFR
Download sequence
Identical sequences F2UP69
XP_004988905.1.12839 PTSG_09992T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]