SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F2USP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2USP5
Domain Number 1 Region: 254-298
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000218
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  F2USP5
Domain Number - Region: 193-259
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00114
Family Complement control module/SCR domain 0.0035
Further Details:      
 
Domain Number - Region: 899-937
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0149
Family Cna protein B-type domain 0.028
Further Details:      
 
Domain Number - Region: 347-380
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0201
Family Fibronectin type III 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F2USP5
Sequence length 2304
Comment (tr|F2USP5|F2USP5_SALR5) Uncharacterized protein {ECO:0000313|EMBL:EGD81154.1} KW=Complete proteome; Reference proteome OX=946362 OS=Salpingoeca rosetta (strain ATCC 50818 / BSB-021). GN=PTSG_11194 OC=Eukaryota; Choanoflagellida; Craspedida; Salpingoecidae; Salpingoeca.
Sequence
MTPPPTTATVMLLLCSVLLASILCQHQANAYYNNFDDPLSFTCSSGQGISSINSYHSNNR
EDRRWSYGCSRYGSGYGSYYTTSYLNDFDGSFDHLCNTNYYIEGAYSYHNNEDRRWRFRC
RRITGATLDYCSKGSYENNLDDPLSYTVRDGYAIAGFASYHDNDNEDRRWQIYTCQINCD
SSDGYVSSGTYGCTRVSCGSLSLTHGTVTGDCGGTFGDQCTYDSCDDGYELSSSGTAGAR
ECRIVSNEGSWSGSPRTCDDINECTTGTHNCVSPATCVNTEGSFYCNCPYGDIDSSGTEC
DVDGPSAVVTEGATSISLAISDATAYPKYEISIGQWALDLSGTTTLPNYPVTVDSPLTSR
TFTGLNPGRRFQVTITPIDNDDNLVTGVQYVGGESSGDIATHCGCLSSDRTGAPSDLALQ
QSLGRVFFSWTDQSYCESGFSFFRDSVGLSANYDVTSEETCGGEHAPTTVYDDLTVQRDD
VYAELDDGSFYAMPEGTFFVRVTSTFDTAGSRFAYPSELASGGHFTSTSTSSTTSTSTST
STSTSSSEVTTSSTSTSTSTEATTASTTGGADLFTTPGVATTTTTTTTSSTSSFQSTTTS
DTDEVVYATGTSTKITRASECATLCKERSDWCIGIVVQQTTSGLVCHQLKLPHFASVSQD
DVSADSYAALTVSSTGVSGTYYLDGSKDDCMQACSDDSDCAMIFVGDGYCATANARTTTS
TNPTSYHEKALPTYFRRYVGTAPGVSRRYCVVATNPVDYDSSGYASASTCKYLTIQWEAI
VRGQVTIDSEEIHLAVEGVEVNFEVGGVTGTRTTDEDGFFEIHIITDQITSLHETMTLSF
SKYTGSIEHTFSCGGMACTETTVVVEHLRFDHEVDIRDTTTMPFSGRVTIEGTEHQGYSN
GCPLKDVEVCLYDRNQGDYVVGCAITDAQGYYTAQAVLGASVGTFVTFGNSSHTFKRVTY
TENTPNAPSGYYIRQDPVTSQDVSTPYYDITEDKLWERIDFKDVTTDTATVDVAGGKCNL
TLGRATIEFRYDNCPTWVRTERTSNRVSKWDLPAQIITVRFKRLVRDGNVREEMTRYFSA
TLGESRSQYVDLRDPKNMNNTLKYARFEYHPEPTLDISFNSEESHSCSYSDGTPLRVIQQ
NTQTLVTIKVTEDYGDSVGTCDVVPGTIEIENHLGESPDTVAVLNETMPSLTNSQLSLLE
RCYYPCEMPVIMDTTSTASGDTLSNSRVQFYILTGSPQTNPEALDSDHPHTKLFRATMQR
LPHDPVTESLYVIVTGDVAQGTGASIPFPRYKPLLVVQDPPGGLSSATYSNTYANYKIES
DTYEEYGGFFFGLEITPFKVDATLDLCVGLGAANCINLLTAKTEPVTIKAETTNLFGSKD
GNDNYDTEKVWSFSLDVTTSEAEVLAGERSDMFLVPSLNVMFLDTDIVEFDTDTCDVTLR
TETTWSLASGENDEAMAWLSAYEIETKELPDLRTRLANADANGDSEDMKAELQNAIDAWE
ENLARNTEVRDMAANGELNAIQQLWSPDTFSLSGKNNINGQMNKGIALAPHKLIESALQL
NDTAATDTQQTGLKAINTIKFSGGGSTYTFAYDTSVDKSVTDGTMREHEFQGGAEISFDI
ASSGVGAEFKLTPLGIGKWSSSHEDQEGYQEEEHVEFTLGDPDPFDVFDVQVFKHPDYNT
LVFHTASGQSSCPHEENTLALEQPGMTVLKRPEAPVLPNEPAVFEIVLRNDGDYTTYMQL
YAVNGENQDGLEISVNGRSLVAPIDYVGFAPGATQITVVMKRGPSAYQYDPVDLWFSSLC
EQERLAETGYLSDEAAAQVRVTLEVEFLQPCSPVQLVGEVGEEGRFVVNKATDEKDERPG
ELRLVAFNSDFATRKWTEDDRLTGVYVEYKPVTSTVWLLARDKDQEALEISTRENDYGYV
TMWWSVESLSEGEYDLRIRAQCQASVNEVPDGIDEQYSITALGVIDRTAPQVLGYPEPAD
GVYEPGDDIAFEFDEPLQCAQPFWFRVRMEVTGVDRVFDNTNMVIVCEGRRITMSLRRGF
SWDEVNARSARLLLTTVEDPYGNRVQQDLTHLFQFADLALSSATVEVTGLMLEVPFEQEF
YNTSSAAFANVTNIIEGDIADALGISQARVKVIAISPTDPSNYHLGIHVDIYLLSPTIEE
LTDSRRRATSQETASALADLLQTIVSNPNSTELSQSNILRRLSPLTDMEVTMMAQQRSTN
STAGPNATTVGSGNNNSGSGDDDNILVPIYVLIALHCVLLVVVVWMFLWLRRRRQTSDSY
KVTPTSAPVSTFEENPATLSLSHV
Download sequence
Identical sequences F2USP5
PTSG_11194T0 XP_004987839.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]