SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F2Z2D3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F2Z2D3
Domain Number - Region: 8-50
Classification Level Classification E-value
Superfamily Rhomboid-like 0.0366
Family Rhomboid-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F2Z2D3
Sequence length 56
Comment (tr|F2Z2D3|F2Z2D3_HUMAN) Nuclease EXOG, mitochondrial {ECO:0000313|Ensembl:ENSP00000400239} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=EXOG OC=Catarrhini; Hominidae; Homo.
Sequence
MAIKSIASRLRGSRRFLSGFVAGAVVGAAGAGLAALQFFRSQGAEGALTGKQPDDC
Download sequence
Identical sequences A0A2I2Y766 A0A2I3SE42 F2Z2D3
ENSP00000400239 ENSP00000406101 ENSP00000407641 ENSP00000412841 ENSP00000400239 ENSP00000406101 ENSP00000407641 ENSP00000412841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]