SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F2Z3T7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2Z3T7
Domain Number 1 Region: 106-290
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 9.55e-51
Family Isochorismatase-like hydrolases 0.0000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F2Z3T7
Sequence length 297
Comment (tr|F2Z3T7|F2Z3T7_RAT) Isochorismatase domain-containing protein 1 {ECO:0000313|Ensembl:ENSRNOP00000026706} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Isoc1 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MAAAEPSVAALAGGGVGAGAPSGGVPVLFCFSVFARPASVPHGAGYDVLIQKFLSLYGDQ
LDMHRKFVVQLFAEEWGQYVDLPKGFAVSERCKLRLVPLQIQLTTLGNLTPPSTVFFCCD
MQERFRPAIKYFGDIISVGQRLLQGARILGIPVIITEQYPKGLGSTVQEIDLTGVKLVLP
KTKFSMVLPEVEAALAEIPGVRSVVLFGVETHVCIQQTALELVGRGIEVHIVADATSSRS
MMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKV
Download sequence
Identical sequences F2Z3T7 Q91V64
10090.ENSMUSP00000025503 10116.ENSRNOP00000026706 ENSRNOP00000026706 ENSMUSP00000025503 ENSRNOP00000026706 ENSMUSP00000025503 ENSMUSP00000025503 NP_079754.2.92730 XP_008772040.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]