SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4B466 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4B466
Domain Number 1 Region: 12-142
Classification Level Classification E-value
Superfamily Prefoldin 0.00000000000000288
Family Prefoldin 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F4B466
Sequence length 147
Comment (tr|F4B466|F4B466_ACIHW) GimC subunit alpha {ECO:0000256|HAMAP-Rule:MF_00308} KW=Complete proteome; Reference proteome OX=933801 OS=Acidianus hospitalis (strain W1). GN=Ahos_1291 OC=Acidianus.
Sequence
MSDQQENKVVISLDDLLAQAQLLKKQIDDLSAARAELLDSVASIEAAKASIQELKSQQEM
LVSSDKKGYLMFKINNQPPQKVLVYLGLSYYVEVDMDTALKILDDRENELKEASTGLDKK
LAESKAAYDQIVDILNQIQAQAQQKGE
Download sequence
Identical sequences F4B466
WP_013776090.1.74519 gi|332796972|ref|YP_004458472.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]