SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4B7L7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4B7L7
Domain Number 1 Region: 5-135
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.35e-29
Family Pseudouridine synthase II TruB 0.0000444
Further Details:      
 
Domain Number 2 Region: 138-215
Classification Level Classification E-value
Superfamily PUA domain-like 8.84e-16
Family PUA domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F4B7L7
Sequence length 221
Comment (tr|F4B7L7|F4B7L7_ACIHW) H/ACA RNA-protein complex component, Cbf5p, C-terminal exon {ECO:0000313|EMBL:AEE93622.1} KW=Complete proteome; Reference proteome OX=933801 OS=Acidianus hospitalis (strain W1). GN=Ahos_0735 OC=Acidianus.
Sequence
METHEKVDLPIVKKIAEEFKGTIYQRPPVRSSVKRRLRTRKVFDIEVLEGKDDKLFLLKI
SSEPGTYMRKICHDMGIILGTGAHMRELRRIRSGIFTENGLVTLQEVSEALYMWKNCKDE
TDLRKILLPMEIGLCGIPKIILDDNAVNAIAYGATANAPGIVAYQNFKKGDLVGLITLKG
EGVAIGKALVDSNSVQQMKKGEVIKPNRILIKRDVYPRAWK
Download sequence
Identical sequences F4B7L7
WP_013775538.1.74519 gi|332796420|ref|YP_004457920.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]