SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4BXB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4BXB1
Domain Number 1 Region: 92-427
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 2.51e-37
Family TM0189-like 0.0044
Further Details:      
 
Weak hits

Sequence:  F4BXB1
Domain Number - Region: 28-84
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000222
Family Type I dockerin domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F4BXB1
Sequence length 436
Comment (tr|F4BXB1|F4BXB1_METSG) Periplasmic binding protein, putative {ECO:0000313|EMBL:AEB68667.1} KW=Complete proteome; Reference proteome OX=990316 OS=NBRC 103675 / OCM 69 / GP-6) (Methanosaeta concilii). GN=MCON_2139 OC=Methanosaetaceae; Methanothrix.
Sequence
MEPNRLIWILIYALVILSPTNAADFVLEIYGNANMDEHLDQADLDYIRDIAAGKTEPTKL
ADANYDGDVDEEDIEQVQAILDGRETRITYIDILGEAETLNKPIKRLVNMGYNGVEMTRI
LGAEDLLVAYGADRSAHKTYLPELSDLPSVSPDEGAQAENADFERIIMLKTDALQTNIER
GSSSTAGRAQKDIFKKNLPDVPLISLNMRELDVLVKNVRTYGYLIDHEKEAEQFIKWYTE
YYNLFESRTKDIPEEERPTAFFEYASEPYNCYASGSNLGQVLVLAGGKNIIDGAVGPDDP
QYKGMIAADPEFIVKENPKYIFEAVASWGDGGYETDDLSKMTASRDQVLNRSELVNVDAV
KENQVYCLDYFLLIGAGNNIIGTAYLAKLFYPDLFEDIDPVAIHQEYVDRFCRIDFNVEE
KGAFLYPPYDRWPVEA
Download sequence
Identical sequences F4BXB1
WP_013719707.1.75657 gi|330508057|ref|YP_004384485.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]