SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4FXW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4FXW9
Domain Number 1 Region: 3-134
Classification Level Classification E-value
Superfamily Pseudouridine synthase 4.03e-33
Family Pseudouridine synthase II TruB 0.0000389
Further Details:      
 
Domain Number 2 Region: 137-214
Classification Level Classification E-value
Superfamily PUA domain-like 0.00000000000000133
Family PUA domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F4FXW9
Sequence length 219
Comment (tr|F4FXW9|F4FXW9_METCR) Pseudouridine synthase (B subunit) {ECO:0000313|EMBL:AEB94167.1} KW=Complete proteome OX=1006006 OS=Metallosphaera cuprina (strain Ar-4). GN=Mcup_0057 OC=Metallosphaera.
Sequence
MEVHCDVNESEIMDVAKTFIGKIYQKPPVRSSVKRRVRKREVYSIDVLEIDKRKVLMRIS
SEPGTYMRKICHDMGILLNCGAHMRELRRVRSGIFKEDTLVTLQQVSEALYLYRNCGEEE
ELRKILMPMEIAFCGVPKIIVDDETVNSISYGSPLMAPGIIAYQDFKKGDYVGLITWKGE
GIAIGKAVIDSKQLGKKGEVVKTERVLMDKDIYPKAWKK
Download sequence
Identical sequences F4FXW9
gi|330833923|ref|YP_004408651.1| WP_013736669.1.2613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]