SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4FZD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4FZD1
Domain Number 1 Region: 152-424
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.92e-74
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000113
Further Details:      
 
Domain Number 2 Region: 3-99
Classification Level Classification E-value
Superfamily tRNA-binding arm 1.36e-19
Family Seryl-tRNA synthetase (SerRS) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F4FZD1
Sequence length 441
Comment (tr|F4FZD1|F4FZD1_METCR) Seryl-tRNA synthetase {ECO:0000313|EMBL:AEB94440.1} KW=Complete proteome OX=1006006 OS=Metallosphaera cuprina (strain Ar-4). GN=Mcup_0332 OC=Metallosphaera.
Sequence
MLIESLRKRGIDPTLAEKAVQLDRKWRSVLQEAEKLRHEHNVVSSQIPKLSAEERKKRIE
EARALLAVLDSKEKELKEIEEERDNLLRALPNLVHESVPVGPDDSYNVPIKVWGKFRVYE
KDLDGFLSQVNGLNAQYELIKFKPTPHADELENVLKLGNTVKASEVAGSRFYYLFDDIVW
IEQALIMYAIDTITSKGFSLVVPPYMLRGEVIQSVIDLDTFKDAIYKIEGEDLYLIATAE
HPIASLFFKEEIEAERLPLKFVGISPAFRKEAGAANKDLKGIFRVHQFNKVEQFIFSLPE
DSWKFHDELLYNAEQIFQGLELPYRVVNIASGDLGACAAKKYDLEVWMPAQAKFREMVSC
SNCTDWQAFRMKIRFVDRKKNRKGYVHTLNSTAVATTRAITAILENNQLEDGSVVIPRVL
RSYLERFKNAPKDVILPKKKG
Download sequence
Identical sequences F4FZD1
gi|330834196|ref|YP_004408924.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]