SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4G114 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4G114
Domain Number 1 Region: 13-144
Classification Level Classification E-value
Superfamily Prefoldin 1.99e-16
Family Prefoldin 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F4G114
Sequence length 148
Comment (tr|F4G114|F4G114_METCR) GimC subunit alpha {ECO:0000256|HAMAP-Rule:MF_00308} KW=Complete proteome OX=1006006 OS=Metallosphaera cuprina (strain Ar-4). GN=Mcup_0599 OC=Metallosphaera.
Sequence
MSDSTSPGRVVVSLEDLLAQADALRKSIDALQKLRDEVYESLNSVKSSKDAINLLKTQGK
DLMLSADRRGYVLLKVNEIPISKVLVNLGLGYYAEIEPDQASKILDEKEDELNKSLQDIT
QRLNKALEEYTQIAEFLNRAQQSQRSGE
Download sequence
Identical sequences F4G114
gi|330834460|ref|YP_004409188.1| WP_013737202.1.2613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]