SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4G143 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4G143
Domain Number 1 Region: 4-170
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.72e-34
Family GHMP Kinase, N-terminal domain 0.00031
Further Details:      
 
Domain Number 2 Region: 185-311
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 3.12e-23
Family Mevalonate kinase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F4G143
Sequence length 316
Comment (tr|F4G143|F4G143_METCR) Mevalonate kinase {ECO:0000256|HAMAP-Rule:MF_00217} KW=Complete proteome OX=1006006 OS=Metallosphaera cuprina (strain Ar-4). GN=Mcup_0628 OC=Metallosphaera.
Sequence
MRTVEALVPLKLTLFGEHAIVYGEPAIAMAISESMKVTVKESDRTIISSSSLHIGNIRVN
LQDMRVESDQISKALSFVIEALNYFEEKRPALINIESSVDPSVGLGTSAAVIVGVIAAYS
KFLGYDFTNLEIAKISRNVEKKVQGLGSRMDTFTTSLGGILYFPRGSENVERLSSLPEIA
SGYVKRTATTAEILRRVKTVKENGREFNEILKLIGLVVEDARDALDKMDVETLGQLMYIN
HGLLMSLGVTSPILDELVSTARNIGLPGCKMSGGGGGGSAVCLKSPKAELLLESRGFKLV
KSELNRTGVTIKEINS
Download sequence
Identical sequences F4G143
gi|330834489|ref|YP_004409217.1| WP_013737231.1.2613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]